PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 269aa    MW: 30637.5 Da    PI: 7.8394
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638786.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+++++G g+W++ +r  g+ R++k+c++rw +yl
   XP_013638786.1 14 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.18.7e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia ++  gRt++++k++w+++
   XP_013638786.1  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLA-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.153961IPR017930Myb domain
SuperFamilySSF466891.29E-3012108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-161461IPR001005SANT/Myb domain
CDDcd001671.64E-111661No hitNo description
PROSITE profilePS5129428.61862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2865116IPR009057Homeodomain-like
SMARTSM007173.1E-1766114IPR001005SANT/Myb domain
PfamPF002496.5E-1667111IPR001005SANT/Myb domain
CDDcd001676.96E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRSPCCEKA HMNKGAWTKE EDQLLVDYIR KHGEGCWRSL PRAAGLQRCG KSCRLRWMNY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLAGRT DNEIKNYWNT HIKRKLLSRG  120
IDPNTHRPIN ESTIPPSKTT TPSLLHDEPV QFDLAKPDQH QTVKPEPTVL YREEGDYNNN  180
NCTSSETTSE EDCVLNLELS VGPATTRSYR YESTRKANLD SIESTGPWGS ELFGAQAGVC  240
LCCRIGFHNE SCRNCRVSDA RTIWESKIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
1h8a_C8e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667360.0KC966736.1 Brassica napus MYB transcription factor 3 (MYB3.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638786.10.0PREDICTED: transcription factor MYB3
SwissprotQ9S9K91e-134MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A0D3CCG90.0A0A0D3CCG9_BRAOL; Uncharacterized protein
STRINGBra024526.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-125myb domain protein 3